PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g066180.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 184aa    MW: 20394.3 Da    PI: 10.4324
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g066180.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-321872155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt eLH++Fv+av++LGG++kAtPk +l+lm++kgLtl+h+kSHLQkYRl
  Sopim06g066180.0.1 18 KPRLRWTAELHQQFVDAVTKLGGPDKATPKLVLRLMGLKGLTLYHLKSHLQKYRL 72
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-311572IPR009057Homeodomain-like
PROSITE profilePS5129412.9531575IPR017930Myb domain
TIGRFAMsTIGR015571.6E-231873IPR006447Myb domain, plants
SuperFamilySSF466893.4E-161873IPR009057Homeodomain-like
PfamPF002491.2E-92071IPR001005SANT/Myb domain
PfamPF143793.5E-11118151IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MGSNLYENDG VVMTRDPKPR LRWTAELHQQ FVDAVTKLGG PDKATPKLVL RLMGLKGLTL  60
YHLKSHLQKY RLGQLAKKQN AAEANKENSG DSSGQFGLHS SGPSTSSLSM NFMQGEVPTT  120
EAVMSQIQVQ KILQEQLQVQ QKLQMRIEAQ GSNNLSSPCF RFTSVKFNGL WREPGLQHRA  180
TNV*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754458e-64HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755188e-64HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241767.11e-135PREDICTED: myb family transcription factor APL-like isoform X2
SwissprotQ9SAK58e-44APL_ARATH; Myb family transcription factor APL
TrEMBLK4C7P61e-135K4C7P6_SOLLC; Uncharacterized protein
STRINGSolyc06g066180.2.11e-134(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44162139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.12e-35G2-like family protein